DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and CG15531

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster


Alignment Length:305 Identity:88/305 - (28%)
Similarity:145/305 - (47%) Gaps:33/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 WDKVIQISLLHI--VAGICLLTYPLRELNPYTTIWSFFVGGVAGFGVTAGAHRFWTHKSYKANTV 171
            |..|:....|:|  |.||.:|   |...:..|.:::..:..:...|||.|.||.|.|:::.|:..
  Fly    24 WPLVLFYIHLNILGVYGIYVL---LTSASWATILFTALLTLLGTLGVTVGVHRLWAHRTFTASKP 85

  Fly   172 LRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMMLKHPEVLRRGR 236
            |:..||.|...|||.::|..|:.||:||...:.|.||:.:...|.::.|...::...|:.....:
  Fly    86 LKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLLKYSPQQEELLK 150

  Fly   237 QIDMSDILADPVVRFHQKYFIPLKTFFCFILPTVIPVYCWGET---------WTLAFIQQCLFRY 292
            .:||||:.:||||.|.:::::.|..|...:|....|...:|::         |..:.|...|...
  Fly   151 DVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDSLATSMFVGFWLRSLIVINLGNL 215

  Fly   293 VSSLNFTWSVNSAAHLWGSRPYDKRIMPSENIYVSLLAMGEGWHNYHHVFPWDYKAAELGNYTVN 357
            |.|.:|.||::.     |.:|.|     |.:|:   |.....|..||::.|.||::.|.|||...
  Fly   216 VHSSHFIWSIHK-----GFKPTD-----SNSIF---LITKSYWPQYHYLLPRDYQSGEYGNYASG 267

  Fly   358 FTTMVLDAFHKLGWAWNMKQPSKELVRRTLEKYGDGTHASQLGGP 402
            ..:.::..|..|.||.::|......||:.|      |.|.:.|.|
  Fly   268 IGSSMIRVFAALDWAKDLKTIGSVAVRQGL------TKAVETGRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 71/249 (29%)
FA_desaturase 140..343 CDD:278890 59/211 (28%)
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
98.920

Return to query results.
Submit another query.