DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet5 and TRS23

DIOPT Version :9

Sequence 1:NP_651778.1 Gene:Bet5 / 43590 FlyBaseID:FBgn0260860 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_010532.3 Gene:TRS23 / 851833 SGDID:S000002654 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:22/101 - (21%)
Similarity:45/101 - (44%) Gaps:25/101 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KEGFLYYKTNRYALHYLETPSGLKFVL-----------------------NTDTTAINVKE-LLQ 98
            |.|.....|:::.:...:|.:|||||.                       :|...||.:.: .|:
Yeast   116 KSGLRQLCTDQFTMFIYQTLTGLKFVAISSSVMPQRQPTIATTDKPDRPKSTSNLAIQIADNFLR 180

  Fly    99 QLYAKVWVEFVVRDPLWTPGTVVTSELFQSKLDEFV 134
            ::|. ::.::|::||.::....:.|.||..|:.:.|
Yeast   181 KVYC-LYSDYVMKDPSYSMEMPIRSNLFDEKVKKMV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet5NP_651778.1 Sybindin 3..137 CDD:282019 22/101 (22%)
TRS23NP_010532.3 TRS23 1..218 CDD:227451 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.