DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet5 and AT1G51160

DIOPT Version :9

Sequence 1:NP_651778.1 Gene:Bet5 / 43590 FlyBaseID:FBgn0260860 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001031168.1 Gene:AT1G51160 / 841539 AraportID:AT1G51160 Length:169 Species:Arabidopsis thaliana


Alignment Length:143 Identity:51/143 - (35%)
Similarity:92/143 - (64%) Gaps:15/143 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVSKISPHDPKEG---------- 60
            :|:|::.|..|.|.||||...: :..:::.||.:|:|||:||..:|:.|.:..:|          
plant    26 MYVFNRNGVCLLYKEWNRPLHT-LNPQQDHKLMFGLLFSLKSLTAKMDPVNADKGNLGVPQLPGQ 89

  Fly    61 ---FLYYKTNRYALHYLETPSGLKFVLNTDTTAINVKELLQQLYAKVWVEFVVRDPLWTPGTVVT 122
               |..::||.|.|.::|||||:|.:|.|.....:::|.|:.:|: ::||:||::|:::||:.:.
plant    90 GCSFHSFRTNTYKLSFMETPSGIKIILVTHPKTGDLRESLKYIYS-LYVEYVVKNPIYSPGSPIK 153

  Fly   123 SELFQSKLDEFVR 135
            ||||.:.||::||
plant   154 SELFNTALDQYVR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet5NP_651778.1 Sybindin 3..137 CDD:282019 51/143 (36%)
AT1G51160NP_001031168.1 TRAPPC1_MUM2 24..164 CDD:341445 49/139 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2314
eggNOG 1 0.900 - - E1_KOG3368
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41425
Inparanoid 1 1.050 102 1.000 Inparanoid score I2162
OMA 1 1.010 - - QHG53597
OrthoDB 1 1.010 - - D1431711at2759
OrthoFinder 1 1.000 - - FOG0005179
OrthoInspector 1 1.000 - - oto3096
orthoMCL 1 0.900 - - OOG6_102947
Panther 1 1.100 - - LDO PTHR23249
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.