DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet5 and Trappc4

DIOPT Version :10

Sequence 1:NP_651778.1 Gene:Bet5 / 43590 FlyBaseID:FBgn0260860 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_068561.1 Gene:Trappc4 / 60409 MGIID:1926211 Length:219 Species:Mus musculus


Alignment Length:137 Identity:33/137 - (24%)
Similarity:66/137 - (48%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVSKISPHDPKEGFLYYKTNRYALH 72
            :.:..|...:|....|..:..:|..|:..|. .|..|:.:..|::||.....|....:|:.:.||
Mouse    82 VLEYLGNPANYPVSIRFGRPRLTSNEKLMLA-SMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLH 145

  Fly    73 YLETPSGLKFVLNTDTTAINVKELLQQLYAKVWVEFVVRDPLWTPGTVVTSELFQSKLD---EFV 134
            ..:|.:|:|||:..|.....:..||:::| :::.:|.:::|.::....:..|||...|.   |..
Mouse   146 CFQTLTGIKFVVLADPRQAGIDSLLRKIY-EIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVA 209

  Fly   135 RQSPIFG 141
            .::..||
Mouse   210 EKAGTFG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet5NP_651778.1 Sybindin 3..137 CDD:282019 31/131 (24%)
Trappc4NP_068561.1 TRAPPC4_synbindin 4..205 CDD:341446 30/124 (24%)

Return to query results.
Submit another query.