DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet5 and TRAPPC1

DIOPT Version :9

Sequence 1:NP_651778.1 Gene:Bet5 / 43590 FlyBaseID:FBgn0260860 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001160093.1 Gene:TRAPPC1 / 58485 HGNCID:19894 Length:145 Species:Homo sapiens


Alignment Length:143 Identity:78/143 - (54%)
Similarity:108/143 - (75%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVSKISPHDPKEGFLYYK 65
            ||:.|||:||:.|..|||:||:|.|::||.:|||.||.|||||||:|||||:||.|.|:|||.::
Human     1 MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQ 65

  Fly    66 TNRYALHYLETPSGLKFVLNTDTTAINVKELLQQLYAKVWVEFVVRDPLWTPGTVVTSELFQSKL 130
            |:||.|||.|||:|:|.|:|||.....::::|..:|:.::||.||::||...|..|.||||:|:|
Human    66 TSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRL 130

  Fly   131 DEFVRQSPIFGIR 143
            |.:||..|.|..|
Human   131 DSYVRSLPFFSAR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet5NP_651778.1 Sybindin 3..137 CDD:282019 73/133 (55%)
TRAPPC1NP_001160093.1 TRAPPC1_MUM2 4..133 CDD:341445 71/128 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143123
Domainoid 1 1.000 159 1.000 Domainoid score I4100
eggNOG 1 0.900 - - E1_KOG3368
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41425
Inparanoid 1 1.050 168 1.000 Inparanoid score I4157
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53597
OrthoDB 1 1.010 - - D1431711at2759
OrthoFinder 1 1.000 - - FOG0005179
OrthoInspector 1 1.000 - - oto90573
orthoMCL 1 0.900 - - OOG6_102947
Panther 1 1.100 - - LDO PTHR23249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R137
SonicParanoid 1 1.000 - - X3695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.