DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet5 and trappc1

DIOPT Version :9

Sequence 1:NP_651778.1 Gene:Bet5 / 43590 FlyBaseID:FBgn0260860 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_021325461.1 Gene:trappc1 / 437015 ZFINID:ZDB-GENE-040718-242 Length:146 Species:Danio rerio


Alignment Length:143 Identity:82/143 - (57%)
Similarity:112/143 - (78%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVSKISPHDPKEGFLYYK 65
            ||:.||||||:.||.|||:||||.|::||::|||.||.|||||||:|||||:||.|.|:|||.::
Zfish     2 MTVHNLYIFDRNGTCLHYSEWNRKKQAGISKEEEFKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQ 66

  Fly    66 TNRYALHYLETPSGLKFVLNTDTTAINVKELLQQLYAKVWVEFVVRDPLWTPGTVVTSELFQSKL 130
            |:||.|||.|||:|::.|:|||.:..|.:|.|||:|:.::|:.:|::||...|..:.||||.|||
Zfish    67 TSRYKLHYYETPTGIRLVMNTDLSVPNCRETLQQIYSTLYVDLIVKNPLCVLGESLQSELFNSKL 131

  Fly   131 DEFVRQSPIFGIR 143
            |.|:|..|.|.:|
Zfish   132 DSFIRALPFFSVR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet5NP_651778.1 Sybindin 3..137 CDD:282019 77/133 (58%)
trappc1XP_021325461.1 Sybindin 4..138 CDD:282019 77/133 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575980
Domainoid 1 1.000 169 1.000 Domainoid score I3779
eggNOG 1 0.900 - - E1_KOG3368
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41425
Inparanoid 1 1.050 180 1.000 Inparanoid score I4001
OMA 1 1.010 - - QHG53597
OrthoDB 1 1.010 - - D1431711at2759
OrthoFinder 1 1.000 - - FOG0005179
OrthoInspector 1 1.000 - - oto40348
orthoMCL 1 0.900 - - OOG6_102947
Panther 1 1.100 - - LDO PTHR23249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R137
SonicParanoid 1 1.000 - - X3695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.