DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet5 and bet5

DIOPT Version :9

Sequence 1:NP_651778.1 Gene:Bet5 / 43590 FlyBaseID:FBgn0260860 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_594073.1 Gene:bet5 / 2543335 PomBaseID:SPAC3G9.16c Length:155 Species:Schizosaccharomyces pombe


Alignment Length:157 Identity:46/157 - (29%)
Similarity:85/157 - (54%) Gaps:19/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIFNLYIFDKFGTLLHYAEWNRTKKSGI-----------TREEEAKLTYGMLFSIKSFVSKISP 54
            |||:..||:.:....:....|..:.::.:           ..::..||.:|::||:::.|.||:.
pombe     1 MTIYAFYIYSRKCECVFAHRWKPSDRNSMETLVSQLEQNSIEDDMEKLIFGVVFSLRNMVKKITA 65

  Fly    55 HDPKEGFLYYKTNRYALHYLETPSGLKFVLNTDTTAINVKELLQQLYAKVWVEFVVRDPLWT--P 117
              .::.|:.|.|::|.||:.|||:.|:.:..|:....::..:|||:|..::|||||:.||:|  |
pombe    66 --DQDQFMSYTTSKYKLHFYETPTNLRLIFITNPKIDSLTHVLQQIYTTLYVEFVVKHPLYTHVP 128

  Fly   118 GTV----VTSELFQSKLDEFVRQSPIF 140
            .:.    :..|:|:..||.|||....|
pombe   129 PSAEEGGINCEIFRITLDRFVRTLSCF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet5NP_651778.1 Sybindin 3..137 CDD:282019 43/150 (29%)
bet5NP_594073.1 Sedlin_N 3..152 CDD:304437 43/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I2477
eggNOG 1 0.900 - - E1_KOG3368
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41425
Inparanoid 1 1.050 78 1.000 Inparanoid score I1867
OMA 1 1.010 - - QHG53597
OrthoFinder 1 1.000 - - FOG0005179
OrthoInspector 1 1.000 - - oto101570
orthoMCL 1 0.900 - - OOG6_102947
Panther 1 1.100 - - LDO PTHR23249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R137
SonicParanoid 1 1.000 - - X3695
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.