DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet5 and Trappc1

DIOPT Version :9

Sequence 1:NP_651778.1 Gene:Bet5 / 43590 FlyBaseID:FBgn0260860 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001019377.1 Gene:Trappc1 / 245828 MGIID:1098727 Length:145 Species:Mus musculus


Alignment Length:143 Identity:79/143 - (55%)
Similarity:109/143 - (76%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVSKISPHDPKEGFLYYK 65
            ||:.|||:||:.|..|||:||:|.|::||.:|||.||.|||||||:|||||:||.|.|:|||.::
Mouse     1 MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQ 65

  Fly    66 TNRYALHYLETPSGLKFVLNTDTTAINVKELLQQLYAKVWVEFVVRDPLWTPGTVVTSELFQSKL 130
            |:||.|||.|||:|:|.|:|||.....::::|..:|:.::|||||::||...|..|.||||:|:|
Mouse    66 TSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVEFVVKNPLCPLGQTVQSELFRSRL 130

  Fly   131 DEFVRQSPIFGIR 143
            |.:||..|.|..|
Mouse   131 DSYVRSLPFFSAR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet5NP_651778.1 Sybindin 3..137 CDD:282019 74/133 (56%)
Trappc1NP_001019377.1 TRAPPC1_MUM2 4..133 CDD:341445 72/128 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833272
Domainoid 1 1.000 161 1.000 Domainoid score I4016
eggNOG 1 0.900 - - E1_KOG3368
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41425
Inparanoid 1 1.050 171 1.000 Inparanoid score I4107
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53597
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005179
OrthoInspector 1 1.000 - - oto94164
orthoMCL 1 0.900 - - OOG6_102947
Panther 1 1.100 - - LDO PTHR23249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R137
SonicParanoid 1 1.000 - - X3695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.