DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15530 and Bad

DIOPT Version :9

Sequence 1:NP_001287603.1 Gene:CG15530 / 43589 FlyBaseID:FBgn0039752 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_006230958.2 Gene:Bad / 64639 RGDID:620103 Length:250 Species:Rattus norvegicus


Alignment Length:135 Identity:28/135 - (20%)
Similarity:49/135 - (36%) Gaps:33/135 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 IPRITSNTTESRWLPRG----EMKESRRIQQITSNTNESRRLPTVTSGEVKESRRSSHPHGDGEY 353
            |..:.|:....||.|..    ::.|....:|..::|.:....|::|..:            .|.|
  Rat    54 IRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTDRGLGPSLTEDQ------------PGPY 106

  Fly   354 --------------RRTSNNQRDGGGGG-ESRSRRSAEKSNPAQSRRHEEQSK--QRRSSNGHPG 401
                          .:.:||...||.|. |:|||.|:..:...:....||:..  :.||.:..|.
  Rat   107 LAPGLLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN 171

  Fly   402 VTKRQ 406
            :...|
  Rat   172 LWAAQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15530NP_001287603.1 None
BadXP_006230958.2 Bcl-2_BAD 73..>195 CDD:402236 23/116 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.