DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15530 and badb

DIOPT Version :9

Sequence 1:NP_001287603.1 Gene:CG15530 / 43589 FlyBaseID:FBgn0039752 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001257524.1 Gene:badb / 58100 ZFINID:ZDB-GENE-000616-1 Length:147 Species:Danio rerio


Alignment Length:127 Identity:24/127 - (18%)
Similarity:47/127 - (37%) Gaps:45/127 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 KSNPAQSRRH---------EEQSKQRRSSNGHPGVTKRQFPDD---------------------- 410
            ||..||.::|         |:..:||..|.....:.:....:|                      
Zfish    28 KSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAA 92

  Fly   411 --HFERLKLENREF---QARRLQASGAAFRQSLSNPTSEGALLTKQENFIENHRQYDRRDVP 467
              :.::|:..:.||   |.:|::::|.| ||...:|:...        |:.:|::.|....|
Zfish    93 KKYGQQLRRMSDEFDKGQMKRVKSAGTA-RQMSQSPSWLA--------FLWSHKESDAESRP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15530NP_001287603.1 None
badbNP_001257524.1 Bcl-2_BAD <51..135 CDD:287485 15/92 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.