DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15530 and Bad

DIOPT Version :9

Sequence 1:NP_001287603.1 Gene:CG15530 / 43589 FlyBaseID:FBgn0039752 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_031548.1 Gene:Bad / 12015 MGIID:1096330 Length:204 Species:Mus musculus


Alignment Length:162 Identity:36/162 - (22%)
Similarity:66/162 - (40%) Gaps:22/162 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 IPRITSNTTESRWLPRG----EMKESRRIQQITSNTNESRRLPTVTSGE----VKESRRSSHPHG 349
            |..:.|:....||.|..    ::.|....:|..::..:....|::|..:    :......|:.|.
Mouse    24 IRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQ 88

  Fly   350 DGEYRRTSNNQRDGGGGGESRSRRSAEKSNPAQSRRHEEQSK--QRRSSNGHPGVTKRQFPDDHF 412
            .|  |..:|:...|.|..|:|||.|:..:...:....||:..  :.||.:..|.:...|   .:.
Mouse    89 QG--RAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQ---RYG 148

  Fly   413 ERLKLENREFQAR-----RLQASGAA--FRQS 437
            ..|:..:.||:..     |.:::|.|  .|||
Mouse   149 RELRRMSDEFEGSFKGLPRPKSAGTATQMRQS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15530NP_001287603.1 None
BadNP_031548.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..138 25/115 (22%)
Bcl-2_BAD 43..204 CDD:287485 31/143 (22%)
BH3 147..161 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..179 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.