DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1983 and AT4G26860

DIOPT Version :9

Sequence 1:NP_001287602.1 Gene:CG1983 / 43588 FlyBaseID:FBgn0039751 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001190850.1 Gene:AT4G26860 / 828793 AraportID:AT4G26860 Length:254 Species:Arabidopsis thaliana


Alignment Length:254 Identity:107/254 - (42%)
Similarity:148/254 - (58%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EFDVKAGLQHVLKRIDEVLLQRPKEVQAARPLLVAVSKTKPAEAVIEAYEGGQRDFGENYVQELE 72
            |..|.:.|:.|:.|..:...|..::.:..|  ::.||||||...:.:.|:.|.|.||||||||:.
plant     7 EATVASALRSVILRARKAAEQVGRDPERVR--VLPVSKTKPVSLIRQIYDAGHRCFGENYVQEII 69

  Fly    73 EKS-RHPDILAKCPDIRWHFIGHMQSNKINKILS-VPNLHMIQTVDSEKLATKLDAAWSKRQPTP 135
            :|: :.|:      ||.|||:||:||||...:|: ||||.|:..||.||:|..||.|.|.   ..
plant    70 DKAPQLPE------DIEWHFVGHLQSNKAKTLLTGVPNLAMVHGVDGEKVANHLDRAVSN---LG 125

  Fly   136 EEPLQVLIQINTSGEDVKSGIEAKDAPALYQYIKSNLKHLNLMGIMTIGAFGFDYSNGPNPDFV- 199
            ..||:||:|:|||||..|||||......|.:::|.:..:|...|:||||.  .||::.|....| 
plant   126 RHPLKVLVQVNTSGEVSKSGIEPSSVVELARHVKHHCPNLVFSGLMTIGM--PDYTSTPENFRVY 188

  Fly   200 --------SLMQVHRSICEAHSLAPDSVLVSMGMSNDFDKAIEMGSTVVRVGSSIFGHR 250
                    :|......:|:|..:|.|...:|||||.||:.|||||||.|||||:|||.|
plant   189 SFPHKPGQTLSNCRADVCKALGMAEDQFELSMGMSGDFELAIEMGSTNVRVGSTIFGPR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1983NP_001287602.1 PLPDE_III_YBL036c_euk 15..248 CDD:143496 102/243 (42%)
AT4G26860NP_001190850.1 PLPDE_III_YBL036c_euk 14..245 CDD:143496 102/243 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 164 1.000 Domainoid score I1225
eggNOG 1 0.900 - - E1_COG0325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5211
Inparanoid 1 1.050 167 1.000 Inparanoid score I1568
OMA 1 1.010 - - QHG53991
OrthoDB 1 1.010 - - D1423577at2759
OrthoFinder 1 1.000 - - FOG0003600
OrthoInspector 1 1.000 - - otm3297
orthoMCL 1 0.900 - - OOG6_101083
Panther 1 1.100 - - LDO PTHR10146
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2475
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.