DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1983 and F09E5.7

DIOPT Version :9

Sequence 1:NP_001287602.1 Gene:CG1983 / 43588 FlyBaseID:FBgn0039751 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_495002.1 Gene:F09E5.7 / 173907 WormBaseID:WBGene00017285 Length:311 Species:Caenorhabditis elegans


Alignment Length:110 Identity:29/110 - (26%)
Similarity:46/110 - (41%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VAVSKTKPAEAVIEAY--EGGQRDFGENYV--------QELEEKSRHPDILAKCPDIRWHFIGHM 95
            |.:|:....||:|..|  :...|....::.        .:|.| ..||.:||....:..:.|..:
 Worm    58 VFISEDGGFEAIITGYVIKNSLRSIAASFTVTPSSSLKSDLSE-GLHPLVLAIGSALTLNHILML 121

  Fly    96 QS--NKINKIL---SVPNLHMIQTVDSEKLATKLDAA----WSKR 131
            .|  :||.|.|   ||..| ::....|:::.|. ||.    |.||
 Worm   122 GSLRDKILKNLTPKSVAKL-ILSNKKSQQILTS-DAVDNTFWKKR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1983NP_001287602.1 PLPDE_III_YBL036c_euk 15..248 CDD:143496 29/110 (26%)
F09E5.7NP_495002.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.