DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1983 and Plpbp

DIOPT Version :9

Sequence 1:NP_001287602.1 Gene:CG1983 / 43588 FlyBaseID:FBgn0039751 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001350408.1 Gene:Plpbp / 114863 MGIID:1891207 Length:332 Species:Mus musculus


Alignment Length:310 Identity:133/310 - (42%)
Similarity:183/310 - (59%) Gaps:62/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLR--RTMAEFDVKAGLQHVLKRIDEVLLQRPKEVQAARPLLVAVSKTKPAEAVIEAYEGGQRDF 63
            |||  ...||..|...|:.|.:|:.:.:.:||:::.|.:|.||||||||||:.|||||..|||.|
Mouse     1 MLRGGSMTAELGVGFALRAVNERVQQSVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTF 65

  Fly    64 GENYVQELEEKSRHPDILAKCPDIRWHFIGHMQSNKINKILSVPNLHMIQTVDSEKLATKLDAAW 128
            ||||||||.||:.:|.||:.||:|:||||||:|...:||:::||||.|::||||.|||.|::::|
Mouse    66 GENYVQELLEKASNPKILSSCPEIKWHFIGHLQKQNVNKLMAVPNLSMLETVDSVKLADKVNSSW 130

  Fly   129 SKRQPTPEEPLQVLIQINTSGEDVKSGIEAKDAPALYQYIKSNLKHLNLMGIMTIGAFGFDYSNG 193
            .|:.||  |||:|::||||||||.|.|:...:..|:.::||::...|..:|:||||:||.|.|.|
Mouse   131 QKKGPT--EPLKVMVQINTSGEDSKHGLLPSETIAVVEHIKASCPSLEFVGLMTIGSFGHDLSQG 193

  Fly   194 PNPDFVSLMQVHRSICEAHSLAPDSVLVSMGMSNDFDKA-------------------------- 232
            |||||..|:.:.|.:||...:..:.|.:|||||.||..|                          
Mouse   194 PNPDFQRLLTLRRELCEKLGIPVEQVELSMGMSMDFQHATDCHKSDPALVRDTRAPNHLQLQLGC 258

  Fly   233 --------------------------------IEMGSTVVRVGSSIFGHR 250
                                            ||:|||.||:||:|||.|
Mouse   259 TLRSLWAARKRLSTSYTAVPDTLSSTFASFPQIEVGSTNVRIGSTIFGER 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1983NP_001287602.1 PLPDE_III_YBL036c_euk 15..248 CDD:143496 124/290 (43%)
PlpbpNP_001350408.1 PLPDE_III_YBL036c_euk 17..306 CDD:143496 124/290 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848668
Domainoid 1 1.000 251 1.000 Domainoid score I2096
eggNOG 1 0.900 - - E1_COG0325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5211
Inparanoid 1 1.050 267 1.000 Inparanoid score I3027
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53991
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003600
OrthoInspector 1 1.000 - - oto94291
orthoMCL 1 0.900 - - OOG6_101083
Panther 1 1.100 - - LDO PTHR10146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1922
SonicParanoid 1 1.000 - - X2475
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.