DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1983 and PLPBP

DIOPT Version :9

Sequence 1:NP_001287602.1 Gene:CG1983 / 43588 FlyBaseID:FBgn0039751 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001336275.1 Gene:PLPBP / 11212 HGNCID:9457 Length:285 Species:Homo sapiens


Alignment Length:254 Identity:124/254 - (48%)
Similarity:180/254 - (70%) Gaps:12/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEFDVKAGLQHVLKRIDEVLLQRPKEVQAARPLLVAVSKTKPAEAVIEAYEGGQRDFGENYVQEL 71
            ||..|...|:.|.:|:.:.:.:||:::.|.:|.||||||||||:.|||||..|||.|||||||||
Human     9 AELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQEL 73

  Fly    72 EEKSRHPDILAKCPDIRWHFIGHMQSNKINKILSVPNLHMIQTVDSEKLATKLDAAWSKRQPTPE 136
            .||:.:|.||:.||:|:||||||:|...:||:::||||.|::||||.|||.|::::| :|:.:||
Human    74 LEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSW-QRKGSPE 137

  Fly   137 EPLQVLIQINTSGEDV----------KSGIEAKDAPALYQYIKSNLKHLNLMGIMTIGAFGFDYS 191
            . |:|::|||||||::          |.|:...:..|:.::|.:...:|..:|:||||:||.|.|
Human   138 R-LKVMVQINTSGEEIYLFSVSFLEGKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLS 201

  Fly   192 NGPNPDFVSLMQVHRSICEAHSLAPDSVLVSMGMSNDFDKAIEMGSTVVRVGSSIFGHR 250
            .||||||..|:.:...:|:..::..|.|.:|||||.||..|:|:|||.||:||:|||.|
Human   202 QGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGER 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1983NP_001287602.1 PLPDE_III_YBL036c_euk 15..248 CDD:143496 118/242 (49%)
PLPBPNP_001336275.1 PLPDE_III_YBL036c_euk 17..258 CDD:143496 118/242 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158271
Domainoid 1 1.000 238 1.000 Domainoid score I2308
eggNOG 1 0.900 - - E1_COG0325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5211
Inparanoid 1 1.050 256 1.000 Inparanoid score I3170
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53991
OrthoDB 1 1.010 - - D1423577at2759
OrthoFinder 1 1.000 - - FOG0003600
OrthoInspector 1 1.000 - - oto90705
orthoMCL 1 0.900 - - OOG6_101083
Panther 1 1.100 - - LDO PTHR10146
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2475
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.