DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1983 and plpbp

DIOPT Version :9

Sequence 1:NP_001287602.1 Gene:CG1983 / 43588 FlyBaseID:FBgn0039751 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002933001.1 Gene:plpbp / 100490708 XenbaseID:XB-GENE-950135 Length:265 Species:Xenopus tropicalis


Alignment Length:250 Identity:125/250 - (50%)
Similarity:174/250 - (69%) Gaps:3/250 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRRTMAEFDVKAGLQHVLKRIDEVLLQRPKEVQAARPLLVAVSKTKPAEAVIEAYEGGQRDFGE 65
            |.|..|:| ::...||.|.:|:.....:|.|.:.|..|.|||||||||.:.||:||..|||.|||
 Frog     1 MWRAGMSE-EIGKALQCVRERVQHAAARRLKTLPAIDPRLVAVSKTKPVDMVIDAYSHGQRYFGE 64

  Fly    66 NYVQELEEKSRHPDILAKCPDIRWHFIGHMQSNKINKILSVPNLHMIQTVDSEKLATKLDAAWSK 130
            ||||||.||:..|::||.||||:||||||:|...|||::.||||::::|:||.|||.|::::|.|
 Frog    65 NYVQELAEKASDPNLLASCPDIKWHFIGHLQKTHINKLVGVPNLYILETIDSIKLADKVNSSWQK 129

  Fly   131 RQPTPEEPLQVLIQINTSGEDVKSGIEAKDAPALYQYIKSNLKHLNLMGIMTIGAFGFDYSNGPN 195
            :..:  |.|:|::|:|||.||.|.|:...:...|.::|:.....|..:|:||||:||:|.:.|||
 Frog   130 KGSS--EKLKVMVQVNTSSEDSKHGLAPTETTELVKHIREKCSSLEFVGLMTIGSFGYDITQGPN 192

  Fly   196 PDFVSLMQVHRSICEAHSLAPDSVLVSMGMSNDFDKAIEMGSTVVRVGSSIFGHR 250
            |||..|:.....:||...|..|||.:|||||:||:.|||:|||.||:||:|||.|
 Frog   193 PDFQMLLAQREEVCEKLGLQIDSVELSMGMSSDFEHAIEVGSTNVRIGSTIFGER 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1983NP_001287602.1 PLPDE_III_YBL036c_euk 15..248 CDD:143496 118/232 (51%)
plpbpXP_002933001.1 PLPDE_III_YBL036c_euk 14..245 CDD:143496 118/232 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 240 1.000 Domainoid score I2224
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5211
Inparanoid 1 1.050 251 1.000 Inparanoid score I3144
OMA 1 1.010 - - QHG53991
OrthoDB 1 1.010 - - D1423577at2759
OrthoFinder 1 1.000 - - FOG0003600
OrthoInspector 1 1.000 - - oto104497
Panther 1 1.100 - - LDO PTHR10146
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2475
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.