DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and MYL10

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_612412.2 Gene:MYL10 / 93408 HGNCID:29825 Length:226 Species:Homo sapiens


Alignment Length:223 Identity:72/223 - (32%)
Similarity:102/223 - (45%) Gaps:50/223 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAPAATPAPAASATGSKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKE--------------- 82
            |.|.......|.....|||.|         .|.|:|||:|.|.||.||||               
Human    17 PRPPKVLGLQAPRRARKRAEG---------TASSNVFSMFDQSQIQEFKESLALSPRLERNGMIS 72

  Fly    83 -------------------AFQLMDADKDGIIGKNDLRAAFDSVGKI-ANDKELDAMLGEASGPI 127
                               ||.:||.::||.|.|.|||..|.::|:| ..::||:||:.||.|||
Human    73 AHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPI 137

  Fly   128 NFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLMNFGDKFTMKEVDDAY 190
            |||..||:|..::.   ..|.:|.::.|||.||.:  |.:..|..:|.||...|:|:.:||...:
Human   138 NFTVFLTMFGEKLK---GTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMF 199

  Fly   191 DQMVIDDKNQIDTAALIEMLTGKGEEEE 218
            .....|....:|...|..::| .|||::
Human   200 AAFPPDVCGNLDYRNLCYVIT-HGEEKD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 56/176 (32%)
MYL10NP_612412.2 FRQ1 40..223 CDD:227455 61/186 (33%)
EF-hand motif 89..118 CDD:320054 12/28 (43%)
EF-hand motif 149..187 CDD:320054 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.