DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and CP1

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_199759.1 Gene:CP1 / 835008 AraportID:AT5G49480 Length:160 Species:Arabidopsis thaliana


Alignment Length:128 Identity:36/128 - (28%)
Similarity:57/128 - (44%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FKEAFQLMDADKDGIIGKNDLRAAFDSVGKIANDKELDAMLG--------EASGPINFTQL-LTL 135
            |:.||:::|.|.||.|..:||||.:..:....|:.|  .|:|        ...|.:.|.:. ..|
plant    19 FRPAFEIIDTDHDGKISSDDLRAFYAGIPSGENNDE--TMIGTMISVADANKDGFVEFDEFEKVL 81

  Fly   136 FANRMATSGANDEDEVVIAAFKTFDNDGLIDGDKFREMLMNFGDKFTMKEVDDAYDQMVIDDK 198
            .....:.||...:|.::...||..|.||  ||      .:::||   :|...|:....|.||:
plant    82 ETTPFSRSGNGGDDGLMKDVFKVMDKDG--DG------RLSYGD---LKSYMDSAGLAVTDDE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 36/128 (28%)
CP1NP_199759.1 EFh_PEF 19..158 CDD:330173 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.