DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and CAM3

DIOPT Version :10

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_191239.1 Gene:CAM3 / 824847 AraportID:AT3G56800 Length:149 Species:Arabidopsis thaliana


Alignment Length:144 Identity:49/144 - (34%)
Similarity:76/144 - (52%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIANDKELDAMLGE----ASGPINFTQLLTLF 136
            ||:||||||.|.|.|.||.|...:|.....|:|:...:.||..|:.|    .:|.|:|.:.|.|.
plant     9 QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73

  Fly   137 ANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLMNFGDKFTMKEVDDAYDQMVIDDKN 199
            |.:|..:   |.:|.:..||:.||.|  |.|...:.|.::.|.|:|.|.:|||:...:..:|...
plant    74 ARKMKDT---DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDG 135

  Fly   200 QIDTAALIEMLTGK 213
            ||:....::::..|
plant   136 QINYEEFVKVMMAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 48/142 (34%)
CAM3NP_191239.1 PTZ00184 1..149 CDD:185504 48/142 (34%)

Return to query results.
Submit another query.