DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and AT3G10190

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_187630.1 Gene:AT3G10190 / 820181 AraportID:AT3G10190 Length:209 Species:Arabidopsis thaliana


Alignment Length:169 Identity:47/169 - (27%)
Similarity:75/169 - (44%) Gaps:21/169 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AASATGSKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDS 106
            |:|::|....:.|..|...|....|.:..|.|.....|..:||:|:|.|.||.:.::||.:....
plant    33 ASSSSGQDCKNSGGDGGGGSVTPTSILPEVPSPYSYVEILQAFKLIDRDNDGAVSRHDLESLLSR 97

  Fly   107 VG-KIANDKELDAMLGE----ASGPINFTQLLTLFANRMAT-SGANDEDEVVIAAFKTF--DNDG 163
            :| ....::|::.||.|    ..|.|...:|    |:|:.: ..|.|..|:. ..|:.|  |.||
plant    98 LGPDPLTEEEINVMLKEVDCDGDGTIRLEEL----ASRVVSLDPARDSTELK-ETFEFFDADRDG 157

  Fly   164 LIDGDKFREMLMNFGD--------KFTMKEVDDAYDQMV 194
            ||..|:...:....||        |..:.:||:..|..|
plant   158 LISADELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 39/138 (28%)
AT3G10190NP_187630.1 EFh 70..132 CDD:238008 19/65 (29%)
EF-hand_7 71..129 CDD:290234 17/61 (28%)
EFh 143..205 CDD:238008 16/55 (29%)
EF-hand_7 144..205 CDD:290234 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.