DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and AT2G41410

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_181672.1 Gene:AT2G41410 / 818739 AraportID:AT2G41410 Length:216 Species:Arabidopsis thaliana


Alignment Length:195 Identity:54/195 - (27%)
Similarity:88/195 - (45%) Gaps:30/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TASEAASEAATPAPAATPAPAASATGSKRASGGSRGSRKSKRAGSSVFSVFSQKQ---IAEFKEA 83
            |.|:|:...:.|:       :.|:..|..:|.||.|:.|.....:.: ||..|..   ..|..:|
plant    18 TKSKASVSRSEPS-------SFSSNASSSSSDGSYGNLKQGPTATPI-SVLPQNSGDFYTELVQA 74

  Fly    84 FQLMDADKDGIIGKNDLRAAFDSVGKIAND----KELDAMLGEASGPINFTQLLTLFANRMA-TS 143
            |:|:|.|.||::.:.||.|.   :.:::::    :|:..||.|..|.......|...|:|:| ||
plant    75 FKLIDRDDDGVVSRGDLAAL---ISRLSHEPPSQEEVSLMLREVDGGDGGCISLEDLASRVAGTS 136

  Fly   144 GAND-EDEVVIAAFKTFDND--GLIDGDKFREMLMNFGD-KFTMKE-------VDDAYDQMVIDD 197
            |... |.|.:...|:.||.|  |.|..::...:....|| :.|::|       ||...|..|..|
plant   137 GEGSVETEELREVFEIFDVDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFD 201

  Fly   198  197
            plant   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 41/144 (28%)
AT2G41410NP_181672.1 PTZ00184 70..208 CDD:185504 40/135 (30%)
EFh 70..133 CDD:238008 19/65 (29%)
EFh 145..207 CDD:238008 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.