DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and Efcab11

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_084448.1 Gene:Efcab11 / 78767 MGIID:1926017 Length:162 Species:Mus musculus


Alignment Length:162 Identity:33/162 - (20%)
Similarity:53/162 - (32%) Gaps:49/162 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSV-----GKIANDKEL 116
            |:|  .|||.:     |..:..::.:.|:..|.|..|.:.:.|.:.|...:     .||..|..:
Mouse     7 GAR--PRAGEA-----SASERRKWVKVFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVM 64

  Fly   117 DAMLGEASG------------------------------PINFTQLLTL--FANRMATSGANDED 149
            .::....||                              .:::...|||  |....:........
Mouse    65 SSVNPNTSGVSLEGFLSAVKRKKEARLYRNEIRQIFTAFDVHYRGFLTLEDFKRAFSRVAPKLPA 129

  Fly   150 EVVIAAFKTFDNDGLIDGD-KFR--EMLMNFG 178
            ..|:..|:..|.|.  ||. .||  |..||.|
Mouse   130 RTVLEVFREADQDS--DGHVSFRDFEYAMNHG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 28/146 (19%)
Efcab11NP_084448.1 FRQ1 14..152 CDD:227455 24/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.