DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and Myl12a

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001344749.1 Gene:Myl12a / 67268 MGIID:1914518 Length:178 Species:Mus musculus


Alignment Length:178 Identity:68/178 - (38%)
Similarity:103/178 - (57%) Gaps:5/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SATGSKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVG 108
            :||.|.:.:......::.:||.|:||::|.|.||.||||||.::|.::||.|.|.||.....|:|
Mouse     4 TATMSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASMG 68

  Fly   109 KIANDKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFR 171
            |...|:.||||:.||.||||||..||:|..::   ...|.::|:..||..||.:  |.|..|..|
Mouse    69 KNPTDEYLDAMMNEAPGPINFTMFLTMFGEKL---NGTDPEDVIRNAFACFDEEAIGTIQEDYLR 130

  Fly   172 EMLMNFGDKFTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEE 219
            |:|...||:||.:|||:.|.:..||.|...:......:|....:::::
Mouse   131 ELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 59/141 (42%)
Myl12aNP_001344749.1 FRQ1 25..175 CDD:227455 63/152 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.