DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and MYL7

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_011513765.1 Gene:MYL7 / 58498 HGNCID:21719 Length:231 Species:Homo sapiens


Alignment Length:235 Identity:74/235 - (31%)
Similarity:116/235 - (49%) Gaps:69/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SKRASGGSRG----SRKSKRAGSSVFSVFSQKQIAEFKE-----------------------AFQ 85
            |::|  |:||    :::::|..|:|||:|.|.||.||||                       ||.
Human     3 SRKA--GTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEVSPPPPTFPRAGGCSHLKAPIPQAFS 65

  Fly    86 LMDADKDGIIGKNDLRAAFDSVGKIA-NDKELDAMLGEASGPINFTQLLTLFANRMATSGANDED 149
            .:|.::||||.|.|||..:..:||:: .::||||||.|..||||||..||||..::   ...|.:
Human    66 CIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKL---NGTDPE 127

  Fly   150 EVVIAAFKTFD--NDGLIDGDKFREMLMNFGDKF-----------------------------TM 183
            |.:::||:.||  ..|:::.|:|:::|:...|||                             |.
Human   128 EAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVRLPSPFNTHPQHLLWAFTHDPEPSTS 192

  Fly   184 KEVDDAYDQMV----IDDKNQIDTAALIEMLTGKGEEEEE 219
            :.|....:||.    :|....||..:|..::| .|:|:||
Human   193 EAVAGRVEQMFALTPMDLAGNIDYKSLCYIIT-HGDEKEE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 59/198 (30%)
MYL7XP_011513765.1 EF-hand_7 62..154 CDD:290234 39/94 (41%)
EF-hand_8 72..157 CDD:290545 37/87 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.