DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and myl10

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001017871.1 Gene:myl10 / 550569 ZFINID:ZDB-GENE-050417-421 Length:167 Species:Danio rerio


Alignment Length:167 Identity:71/167 - (42%)
Similarity:106/167 - (63%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGK--IANDKELDAML 120
            ::|.:.|.|:|||:|.|.||.||||||.:||.::||.|.|||||..|.::|:  :.|| |||.||
Zfish     6 AKKKEAASSNVFSMFEQSQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRLNVGND-ELDEML 69

  Fly   121 GEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLMNFGDKFTM 183
            .|||||||||..|::|..::.   ..|.:|.::.|||.||.:  |::.|::.:..||:..||||.
Zfish    70 KEASGPINFTIFLSMFGEKLK---GTDPEETILNAFKIFDPEGTGILKGEEIKYHLMSQVDKFTE 131

  Fly   184 KEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEEE 220
            .||:..:....:|....:|...|..::| .||::|:|
Zfish   132 AEVNQMFTNFPLDVAGNLDYKNLCYVIT-HGEDKEQE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 60/143 (42%)
myl10NP_001017871.1 FRQ1 13..163 CDD:227455 66/154 (43%)
EFh 27..85 CDD:298682 35/58 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_122477
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.