DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and myl9a

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001006027.1 Gene:myl9a / 450006 ZFINID:ZDB-GENE-041010-120 Length:174 Species:Danio rerio


Alignment Length:176 Identity:67/176 - (38%)
Similarity:104/176 - (59%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TGSKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKI 110
            :.:|||.|.:. .::.:||.|:||::|.|.||.||||||.::|.::||.|.|.||.....|:||.
Zfish     2 SAAKRAKGKTT-RKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKN 65

  Fly   111 ANDKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREM 173
            .:|:.|:.|:.||.||||||..||:|..|:   ...|.::|:..||..||.|  |.|..|..|::
Zfish    66 PSDEYLEGMMSEAPGPINFTMFLTMFGERL---NGTDPEDVIRNAFTCFDEDATGFIHEDHLRDL 127

  Fly   174 LMNFGDKFTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEE 219
            |...||:||.:|||:.:.:..||.|...:......:|....:::::
Zfish   128 LTTMGDRFTDEEVDELFREAPIDKKGNFNYVEFTRILKHGAKDKDD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 57/141 (40%)
myl9aNP_001006027.1 FRQ1 20..170 CDD:227455 61/152 (40%)
EFh 34..>78 CDD:238008 19/43 (44%)
EFh 104..165 CDD:298682 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.