DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and mylpfb

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001004668.1 Gene:mylpfb / 447930 ZFINID:ZDB-GENE-040912-115 Length:170 Species:Danio rerio


Alignment Length:175 Identity:69/175 - (39%)
Similarity:107/175 - (61%) Gaps:17/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKI-AN 112
            ::|.|||          |:|||:|.|.||.|:||||.::|.::||||.|:|||....::|:: ..
Zfish    10 QQAEGGS----------SNVFSMFEQSQIQEYKEAFTIIDQNRDGIISKDDLRDVLATMGQLNVK 64

  Fly   113 DKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLM 175
            ::||:||:.|||||||||..||:|..::  .||:.|| |:::|||..|.:  |.|..:...|:|.
Zfish    65 NEELEAMVKEASGPINFTVFLTMFGEKL--KGADPED-VIVSAFKVLDPEATGTIKKEFLEELLT 126

  Fly   176 NFGDKFTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEEE 220
            ...|:||.:|:.:.:.....|....:|...:..::| .|||:|||
Zfish   127 TQCDRFTAEEMKNLWAAFPPDVAGNVDYKNICYVIT-HGEEKEEE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 54/142 (38%)
mylpfbNP_001004668.1 FRQ1 16..165 CDD:227455 60/162 (37%)
EFh 30..88 CDD:238008 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.