DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and myl12.1

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_999864.1 Gene:myl12.1 / 326719 ZFINID:ZDB-GENE-030131-4918 Length:172 Species:Danio rerio


Alignment Length:174 Identity:69/174 - (39%)
Similarity:102/174 - (58%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIAN 112
            ||||. |....::.:||.|:||::|.|.||.||||||.::|.::||.|.|.||.....|:||...
Zfish     3 SKRAK-GKITKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPA 66

  Fly   113 DKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLM 175
            |..|:||:.||.||||||..||:|..::   ...|.:||:..||..||.:  |.|..|..||:|.
Zfish    67 DDYLEAMMTEAPGPINFTMFLTMFGEKL---NGTDPEEVIRNAFACFDEEGTGFIHEDYLRELLT 128

  Fly   176 NFGDKFTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEE 219
            ..||:||.:|||:.:.:..||.|:..:......:|....:::::
Zfish   129 TMGDRFTDEEVDELFREAPIDKKSNFNYVEFTRILKHGAKDKDD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 58/141 (41%)
myl12.1NP_999864.1 FRQ1 19..169 CDD:227455 62/152 (41%)
EFh 33..>77 CDD:238008 20/43 (47%)
EFh 103..164 CDD:298682 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.