DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and CG33098

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001262501.1 Gene:CG33098 / 326253 FlyBaseID:FBgn0053098 Length:230 Species:Drosophila melanogaster


Alignment Length:215 Identity:64/215 - (29%)
Similarity:102/215 - (47%) Gaps:25/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ASEAASEAATPAPAATPAPAA---------SATGSKRASGGSRGSRKSKRAGSSVF-SVFSQKQI 77
            ||.|..::.||.||:..|.:.         :.|.....|.|.....:..||..:|. ......::
  Fly    19 ASSARKQSHTPQPASHLADSEAMAVINEIFNPTLKLPESSGHYTLPEEMRADDNVAPHELDIAKL 83

  Fly    78 AEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIANDKELDAMLGEASGPINFTQLLTLFANRMAT 142
            ||.||.|.|.|.|.||:|.|:|||..:.::|...|::.|:.|:.||..|:::...:.|.:.|   
  Fly    84 AELKEVFSLFDTDCDGLISKDDLRFTYTALGNEPNEQLLEQMMQEAKEPLDYEAFVRLMSRR--- 145

  Fly   143 SGANDEDEVVIAAFKTFDNDGL--IDGDKFREMLMNFGDKFTMKEVDDAYDQ------MVIDDKN 199
            :...|.::|::.|:..:|:.|.  ||..|..|.|.|:|||.|:.|..:|...      ..:::..
  Fly   146 TQELDPEDVLLEAWSKWDDHGTGKIDERKIYEELTNYGDKMTLNEAKEALSHAPMAKPKSLEEPP 210

  Fly   200 QIDTAALIEMLTG----KGE 215
            .||..|...||:|    |||
  Fly   211 MIDYPAFCRMLSGMRKRKGE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 47/151 (31%)
CG33098NP_001262501.1 FRQ1 76..195 CDD:227455 40/121 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.