DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and sqh

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster


Alignment Length:178 Identity:71/178 - (39%)
Similarity:107/178 - (60%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SKRASGGSRGS--RKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKI 110
            |.|.:.|.|.:  ::::||.|:||::|.|.|||||||||.::|.::||.:.|.||.....|:||.
  Fly     2 SSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKN 66

  Fly   111 ANDKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFD--NDGLIDGDKFREM 173
            ..|..||.|:.||.||||||..||||..|:.   ..|.::|:..||..||  |.|::..|:.||:
  Fly    67 PTDDYLDGMMNEAPGPINFTMFLTLFGERLQ---GTDPEDVIKNAFGCFDEENMGVLPEDRLREL 128

  Fly   174 LMNFGDKFTMKEVDDAYDQMVIDDKNQI-DTAALIEMLTGKGEEEEEE 220
            |...||:||.::||:.|.:..|  ||.: |......:|....::::|:
  Fly   129 LTTMGDRFTDEDVDEMYREAPI--KNGLFDYLEFTRILKHGAKDKDEQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 60/142 (42%)
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 66/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I3081
eggNOG 1 0.900 - - E2759_KOG0031
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.