DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and Myl9

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001094355.2 Gene:Myl9 / 296313 RGDID:1311235 Length:172 Species:Rattus norvegicus


Alignment Length:174 Identity:67/174 - (38%)
Similarity:101/174 - (58%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIAN 112
            ||||...:. .::.:||.|:||::|.|.||.||||||.::|.::||.|.|.||.....|:||...
  Rat     3 SKRAKAKTT-KKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPT 66

  Fly   113 DKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLM 175
            |:.|:.|:.||.||||||..||:|..::   ...|.::|:..||..||.:  |.|..|..||:|.
  Rat    67 DEYLEGMMNEAPGPINFTMFLTMFGEKL---NGTDPEDVIRNAFACFDEEASGFIHEDHLRELLT 128

  Fly   176 NFGDKFTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEE 219
            ..||:||.:|||:.|.:..||.|...:......:|....:::::
  Rat   129 TMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 57/141 (40%)
Myl9NP_001094355.2 FRQ1 19..169 CDD:227455 61/152 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.