DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and rlc1

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_594364.1 Gene:rlc1 / 2543545 PomBaseID:SPAC926.03 Length:184 Species:Schizosaccharomyces pombe


Alignment Length:154 Identity:50/154 - (32%)
Similarity:80/154 - (51%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SATGSKRA--SGGSRGSRK-----SKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLR 101
            ::.|:|||  |..:..|::     :|||.|..|:..:..||.|.||||.|:|.|.||.||:.|::
pombe     7 NSLGAKRAPFSSNTTSSQRVAAQAAKRASSGAFAQLTSSQIQELKEAFALLDKDGDGNIGREDVK 71

  Fly   102 AAFDSVGKIANDKELDAMLGEASGPINFTQLLTLFANRMA-TSGANDEDEVVIAAFKTFDN--DG 163
            ....|:.:.|::..::.|....:.|||....||...:.:. .|..||    ::.||.|||:  .|
pombe    72 TMLTSLNQDASEDSINHMFESINPPINLAAFLTAMGSMLCRISPRND----LLEAFSTFDDTQSG 132

  Fly   164 LIDGDKFREMLMNFGDKFTMKEVD 187
            .|.....|:.|.:.||:...:||:
pombe   133 KIPISTMRDALSSMGDRMDPQEVE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 39/118 (33%)
rlc1NP_594364.1 FRQ1 35..183 CDD:227455 41/126 (33%)
EFh 49..106 CDD:238008 21/56 (38%)
EFh 118..178 CDD:298682 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3081
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.960

Return to query results.
Submit another query.