DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and Mylpf

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038953516.1 Gene:Mylpf / 24584 RGDID:3141 Length:191 Species:Rattus norvegicus


Alignment Length:170 Identity:66/170 - (38%)
Similarity:93/170 - (54%) Gaps:36/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RKSKR-----AGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKI-ANDKELD 117
            :|:||     ..|:|||:|.|.||.||||||.::|.::||||.|.|||..|.::|:: ..::|||
  Rat     4 KKAKRRAAAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELD 68

  Fly   118 AMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLMNFGDK 180
            ||:.|||||||||..||:|..::  .||:.|| |:..|||..|.:  |.|......|:|....|:
  Rat    69 AMMKEASGPINFTVFLTMFGEKL--KGADPED-VITGAFKVLDPEGKGTIKKQFLEELLTTQCDR 130

  Fly   181 FTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEEE 220
            |:.:||                         .:||..||:
  Rat   131 FSQEEV-------------------------SRGEPREEK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 54/142 (38%)
MylpfXP_038953516.1 FRQ1 15..136 CDD:227455 57/123 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.