DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and Myl2

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001371255.1 Gene:Myl2 / 17906 MGIID:97272 Length:166 Species:Mus musculus


Alignment Length:179 Identity:71/179 - (39%)
Similarity:104/179 - (58%) Gaps:17/179 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ASATGSKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSV 107
            |.....||..|||          |:|||:|.|.||.||||||.:||.::||.|.|||||..|.::
Mouse     2 APKKAKKRIEGGS----------SNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAAL 56

  Fly   108 GKI-ANDKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDK 169
            |:: ..::|:|.|:.||.||||||..||:|..::  .|| |.:|.::.|||.||.:  |.:..|.
Mouse    57 GRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKL--KGA-DPEETILNAFKVFDPEGKGSLKADY 118

  Fly   170 FREMLMNFGDKFTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEE 218
            .||||....::|:.:|:|..:.....|....:|...|:.::| .|||::
Mouse   119 VREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIIT-HGEEKD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 57/142 (40%)
Myl2NP_001371255.1 FRQ1 14..163 CDD:227455 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1105
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.