DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and LOC1276971

DIOPT Version :10

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_061505119.1 Gene:LOC1276971 / 1276971 VectorBaseID:AGAMI1_001308 Length:204 Species:Anopheles gambiae


Alignment Length:86 Identity:15/86 - (17%)
Similarity:27/86 - (31%) Gaps:38/86 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VQNSRCPIYNPAKPVLLPGPTCDRFYKCESGRACETLCPGGTHFNAREQACDWPHRACCDPNIEC 100
            ::|....|:...||.:..|  |..|:|.:                               ..::.
Mosquito   366 LKNHMKKIHKQQKPYMCEG--CHDFFKIK-------------------------------VELQS 397

  Fly   101 RPDPCGPNDNRCPMFDGLKPT 121
            ..:.|.    :||: ||.||:
Mosquito   398 HVEHCA----KCPV-DGDKPS 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 7/49 (14%)
LOC1276971XP_061505119.1 None

Return to query results.
Submit another query.