DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and myl10

DIOPT Version :9

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001123682.1 Gene:myl10 / 100170437 XenbaseID:XB-GENE-986520 Length:168 Species:Xenopus tropicalis


Alignment Length:168 Identity:70/168 - (41%)
Similarity:100/168 - (59%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKI-ANDKELDAM 119
            :..:|::.|.|:|||:|.|.||.||||||.:||.::||.|.|.|||..|.::|:| ...:|||.|
 Frog     5 KAKKKAEGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKGDLRDTFAALGRINVKSEELDDM 69

  Fly   120 LGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDNDGL--IDGDKFREMLMNFGDKFT 182
            :.||.||||||..||:|..::.   ..|.:|.::.|||.||.||.  |..|..||||....|:||
 Frog    70 VQEAPGPINFTVFLTMFGEKLK---GTDPEETILNAFKIFDPDGKGHIKADYIREMLTTQADRFT 131

  Fly   183 MKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEEE 220
            .:|:...:.....|....:|...|..::| .|||:::|
 Frog   132 QEEITQMFTAFPPDVAGNLDYKNLCYIIT-HGEEKDQE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 59/142 (42%)
myl10NP_001123682.1 FRQ1 14..163 CDD:227455 64/152 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.