DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and si:dkeyp-117b11.1

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_017212885.1 Gene:si:dkeyp-117b11.1 / 798129 ZFINID:ZDB-GENE-081104-453 Length:390 Species:Danio rerio


Alignment Length:103 Identity:30/103 - (29%)
Similarity:56/103 - (54%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EKEQYYFTVDRPTAER-MLHGREDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFIRQVDRRQRY 150
            :|:.:....||.|||. :|...:||:.||| |..:.....|.:.:......|::.:|.::..|:|
Zfish   278 DKDWFAGDCDRKTAEETVLRMNKDGTFLVR-FSNSQNSQPYTLVVLYHQNVYNIPVRFLEDSQQY 341

  Fly   151 AIGQ--KKSQERCFGSPSEIVEFYTEHPLLCTNKVRSQ 186
            .:|:  |||:| .|.|..|::..:..:|:|..:: :||
Zfish   342 VLGKGGKKSEE-LFSSLQEMISHHMMNPILLIDR-KSQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 30/103 (29%)
si:dkeyp-117b11.1XP_017212885.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NC9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.