DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and blnk

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_012821984.1 Gene:blnk / 548350 XenbaseID:XB-GENE-946366 Length:547 Species:Xenopus tropicalis


Alignment Length:114 Identity:32/114 - (28%)
Similarity:61/114 - (53%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YVIVDDADVNYAEIEERH--VEKEQYYFTVDRPTAERMLHGR-EDGSCLVRPFKAADQWIRYIVS 129
            ||:......:::..||..  :.|:.|..:.||.|||..|:.. :|||.|||.....|....|.:.
 Frog   413 YVVNPSRKNSHSSPEEEAGVLNKDWYAASCDRKTAEEALYASCKDGSYLVRQSSGQDPKQPYTLV 477

  Fly   130 IWAADQYYHLFIRQVDRRQRYAIGQKKSQERCFGSPSEIVEFYTEHPLL 178
            ::...:.|::.:|.::..:::|:|::||.|..|.|.:|::..:...||:
 Frog   478 VFYNRKVYNIPVRFIEETRQFALGREKSGEEKFSSVAEMITCHQRMPLV 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 30/100 (30%)
blnkXP_012821984.1 PHA03247 <108..408 CDD:223021
SH2_BLNK_SLP-76 425..545 CDD:198183 30/102 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12083
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.