DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and Blnk

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001020938.1 Gene:Blnk / 499356 RGDID:1561933 Length:457 Species:Rattus norvegicus


Alignment Length:102 Identity:32/102 - (31%)
Similarity:55/102 - (53%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YAEIEERHVEKEQYYFTVDRPTAERMLH-GREDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFI 141
            :|:.|.....|..|....||.:||..|| ..:|||.|:|.....|....|.:..:...:.|::.:
  Rat   335 FADQEAELHGKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVAFFNKRVYNIPV 399

  Fly   142 RQVDRRQRYAIGQKKSQERCFGSPSEIVEFYTEHPLL 178
            |.::..::||:|:||:.|..|||..||::.:..:||:
  Rat   400 RFIEATKQYALGKKKNGEEYFGSVVEIIKNHQHNPLV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 31/98 (32%)
BlnkNP_001020938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..306
DUF2890 154..>266 CDD:287991
SH2_BLNK_SLP-76 335..455 CDD:198183 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11578
eggNOG 1 0.900 - - E1_28NC9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98117
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.