DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and BLNK

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_037446.1 Gene:BLNK / 29760 HGNCID:14211 Length:456 Species:Homo sapiens


Alignment Length:153 Identity:41/153 - (26%)
Similarity:72/153 - (47%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VRSPTFCSCCFGYQRQASQEGDVAERVSSTDDDPQQQPREDYVIVDDADVNYAEIEERHVEKEQY 91
            |:||.|...    |:|..|:.....|.:...:.....|...:    .::...:|.|...:.|..|
Human   291 VQSPVFPPA----QKQIHQKPIPLPRFTEGGNPTVDGPLPSF----SSNSTISEQEAGVLCKPWY 347

  Fly    92 YFTVDRPTAERMLH-GREDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFIRQVDRRQRYAIGQK 155
            ....||.:||..|| ..:|||.|:|.....|....|.:.::...:.|::.:|.::..::||:|:|
Human   348 AGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRK 412

  Fly   156 KSQERCFGSPSEIVEFYTEHPLL 178
            |:.|..|||.:||:..:...||:
Human   413 KNGEEYFGSVAEIIRNHQHSPLV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 31/98 (32%)
BLNKNP_037446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..301 4/13 (31%)
SH2_BLNK_SLP-76 336..454 CDD:198183 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11671
eggNOG 1 0.900 - - E1_28NC9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto91022
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.