DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and SH2D6

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_016859323.1 Gene:SH2D6 / 284948 HGNCID:30439 Length:345 Species:Homo sapiens


Alignment Length:137 Identity:35/137 - (25%)
Similarity:66/137 - (48%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ASQEGDVAERVSSTDDDPQQQPREDYVIVDDADVNYAEIEERHVEKEQYYFTVDRPTAE-RMLHG 106
            ||:||    |.||.   |...|.......:|:|:         :.:..|....||...| .:||.
Human   204 ASKEG----RKSSL---PSVAPTGSASAAEDSDL---------LTQPWYSGNCDRYAVESALLHL 252

  Fly   107 REDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFIRQVDRRQRYAIGQK-KSQERCFGSPSEIVE 170
            ::||:..|||.........:.:::....:.:::.||::|..:.||:|:: :::|..|.|.:.:|:
Human   253 QKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQ 317

  Fly   171 FYTEHPL 177
            .:..|||
Human   318 HFMWHPL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 24/98 (24%)
SH2D6XP_016859323.1 SH2_BLNK_SLP-76 223..344 CDD:198183 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11671
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.