DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and Lcp2

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_034826.2 Gene:Lcp2 / 16822 MGIID:1321402 Length:533 Species:Mus musculus


Alignment Length:111 Identity:32/111 - (28%)
Similarity:53/111 - (47%) Gaps:5/111 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EERHVEKEQYYFTVDRPTAERMLHG-REDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFIRQVD 145
            ||..:::|.|...:.||.||..|.. .:||:.|||..........|::.:...|:.|::.||..:
Mouse   414 EETPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNPYVLMVLYKDKVYNIQIRYQE 478

  Fly   146 RRQRYAIGQKKSQERCFGSPSEIVEFYTEHPLLC----TNKVRSQC 187
            ..|.|.:|.....:..|.|.|:|::::.:.|||.    ....|.||
Mouse   479 ESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQC 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 32/111 (29%)
Lcp2NP_034826.2 SAM_SLP76 10..78 CDD:188921
SAM 12..>56 CDD:197735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..359
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..419 2/4 (50%)
SH2_BLNK_SLP-76 411..531 CDD:198183 32/111 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11843
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.