DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and Lcp2

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_038941032.1 Gene:Lcp2 / 155918 RGDID:619743 Length:531 Species:Rattus norvegicus


Alignment Length:111 Identity:32/111 - (28%)
Similarity:53/111 - (47%) Gaps:5/111 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EERHVEKEQYYFTVDRPTAERMLHG-REDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFIRQVD 145
            ||..:::|.|...:.||.||..|.. .:||:.|||..........|::.:...|:.|::.||..:
  Rat   412 EESPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTVNNPYVLMVLYKDKVYNIQIRYQE 476

  Fly   146 RRQRYAIGQKKSQERCFGSPSEIVEFYTEHPLLC----TNKVRSQC 187
            ..|.|.:|.....:..|.|.|:|::::.:.|||.    ....|.||
  Rat   477 ESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQC 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 32/111 (29%)
Lcp2XP_038941032.1 SAM_SLP76 10..78 CDD:188921
PHA03247 <130..415 CDD:223021 2/2 (100%)
SH2_BLNK_SLP-76 408..529 CDD:198183 32/111 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.