DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15529 and CLNK

DIOPT Version :9

Sequence 1:NP_001303487.1 Gene:CG15529 / 43584 FlyBaseID:FBgn0039748 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_011512077.1 Gene:CLNK / 116449 HGNCID:17438 Length:443 Species:Homo sapiens


Alignment Length:140 Identity:33/140 - (23%)
Similarity:62/140 - (44%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PQQQPREDYVIVDDADVNYAEIEERHVEKEQYYFTVDRPTAERMLHGREDGSCLVRPFKAADQWI 124
            |::..|:|   |...:....|...:.||             |..:...:|||.|||......:..
Human   311 PKRSDRKD---VQHNEWYIGEYSRQAVE-------------EAFMKENKDGSFLVRDCSTKSKEE 359

  Fly   125 RYIVSIWAADQYYHLFIRQVDRRQRYAIGQKKSQERCFGSPSEIVEFYTEHPLLC------TNKV 183
            .|:::::..::.|::.||.::|.|::|:|.....:..|.|..:|:|.|...|::.      |...
Human   360 PYVLAVFYENKVYNVKIRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVH 424

  Fly   184 RSQCVQLRPI 193
            |.||...:|:
Human   425 RKQCHLTQPL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15529NP_001303487.1 SH2 82..188 CDD:301589 26/111 (23%)
CLNKXP_011512077.1 SH2_BLNK_SLP-76 312..432 CDD:198183 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11671
eggNOG 1 0.900 - - E1_28NC9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.