DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and GALR2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_003848.1 Gene:GALR2 / 8811 HGNCID:4133 Length:387 Species:Homo sapiens


Alignment Length:361 Identity:87/361 - (24%)
Similarity:134/361 - (37%) Gaps:138/361 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLHACLF 114
            |:.:|..:||.||:.|..|..:....||.:|::|.:|||......:||            .|.::
Human    34 LIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPF------------QATIY 86

  Fly   115 TV------SLL------VVLCTI--SIFCLVAVSVDRYWAILYPMAYSRNVRT-RTAIFIISMCW 164
            |:      |||      ::..|:  |.|.|.|||:|||.||.||: :||.:|| |.|:..|.:.|
Human    87 TLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPL-HSRELRTPRNALAAIGLIW 150

  Fly   165 VAGTIVGFLPLF---------------------GWHADVNHNQE-CLFVEVMDYNYLVFLYFATI 207
                  |...||                     .|.|......: |.||    ::||:       
Human   151 ------GLSLLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDICTFV----FSYLL------- 198

  Fly   208 ITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAAR 272
              |.|::...|....|.:.:.|..:..                     |.|            ||
Human   199 --PVLVLGLTYARTLRYLWRAVDPVAA---------------------GSG------------AR 228

  Fly   273 KRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCI---------------IL 322
            :...|.|:.:.|:...|.:||:|.:.:                 :.|:               ||
Human   229 RAKRKVTRMILIVAALFCLCWMPHHAL-----------------ILCVWFGQFPLTRATYALRIL 276

  Fly   323 SHL----NSAVNPVLYAYHLKDFRAALKNLLLKMMG 354
            |||    ||.|||::||...|.||...:.:...::|
Human   277 SHLVSYANSCVNPIVYALVSKHFRKGFRTICAGLLG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 56/204 (27%)
7tm_1 58..334 CDD:278431 79/331 (24%)
GALR2NP_003848.1 7tm_4 32..>177 CDD:304433 47/161 (29%)
7tm_1 42..292 CDD:278431 79/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.