DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and KISS1R

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_115940.2 Gene:KISS1R / 84634 HGNCID:4510 Length:398 Species:Homo sapiens


Alignment Length:338 Identity:85/338 - (25%)
Similarity:139/338 - (41%) Gaps:46/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAKDSDSPSSELNIPYTV--FEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVG 91
            :|.|...||......:.|  |...:.::.::||.|||.|..|.:.:|..||:||.:||..|:...
Human    28 NASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFL 92

  Fly    92 ALGIPF-AILASM-GLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTR 154
            ...:|| |:|..: |.......|.|...:..|....:...|.|:||||::..::|:........|
Human    93 LCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPR 157

  Fly   155 TAIFIISMCWVAGTIVGFLPLFGWH----ADVNHNQECLFVEVMDYNYLVFLYFATIITPALLML 215
            .|:.:....||....|. .|:...|    ....:..|......::..:.::...|..:.|.|...
Human   158 LALAVSLSIWVGSAAVS-APVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATC 221

  Fly   216 AFYT----HIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDV 276
            |.|.    |:.||.::..       ||      .||...||           :....||.|   .
Human   222 ACYAAMLRHLGRVAVRPA-------PA------DSALQGQV-----------LAERAGAVR---A 259

  Fly   277 KATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPK------LTLFCIILSHLNSAVNPVLYA 335
            |.::.::.:||.|..||.|:.....::|..|....||:      |..:...:|:.|||:||:|||
Human   260 KVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYA 324

  Fly   336 YHLKDFRAALKNL 348
            :....||.|.:.:
Human   325 FLGSHFRQAFRRV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/177 (24%)
7tm_1 58..334 CDD:278431 73/291 (25%)
KISS1RNP_115940.2 7tm_4 53..>157 CDD:304433 30/103 (29%)
7tm_1 59..323 CDD:278431 73/291 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.