DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and QRFPR

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_937822.2 Gene:QRFPR / 84109 HGNCID:15565 Length:431 Species:Homo sapiens


Alignment Length:362 Identity:83/362 - (22%)
Similarity:151/362 - (41%) Gaps:89/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMG--------- 104
            ||:..:::.||.||..|..|.:.:|..||.:|.|||::|||:....||..:|.::.         
Human    53 VLIFALALFGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFI 117

  Fly   105 ---LPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVA 166
               :|       |..|..||...:::.|   ::|:|:..:::|.........|.|..::.:.|:.
Human   118 CKMVP-------FVQSTAVVTEILTMTC---IAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLV 172

  Fly   167 GTIVGFLPLFGWHA-------DVNHNQE--CLFVE----VMDYNYLVFLYFATIITPALLMLAFY 218
            ..||| .|:  ||.       |..:.:|  |...|    |....|..|:.....:.|.::||..|
Human   173 AVIVG-SPM--WHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILY 234

  Fly   219 THI-YRVIIKQ------VRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDV 276
            :.| |.:.||:      |.:.:.....|.::|:...||:.:.|                      
Human   235 SKIGYELWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVT---------------------- 277

  Fly   277 KATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLT---LFCI--ILSHLNSAVNPVLYAY 336
                    :|..|.:||.|.:.::.:..:......:..:|   :|.|  |:...||..||::||:
Human   278 --------VVALFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAF 334

  Fly   337 HLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVASQH 373
            ..::|:   ||:|..:....:::      .||.|.:|
Human   335 MNENFK---KNVLSAVCYCIVNK------TFSPAQRH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 48/192 (25%)
7tm_1 58..334 CDD:278431 71/312 (23%)
QRFPRNP_937822.2 7tm_1 62..332 CDD:278431 71/312 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.