DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and TAAR8

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_444508.1 Gene:TAAR8 / 83551 HGNCID:14964 Length:342 Species:Homo sapiens


Alignment Length:342 Identity:90/342 - (26%)
Similarity:151/342 - (44%) Gaps:70/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAI 99
            ||.|.: |.||.|. ..:::::.||:||:......::|...||:.|.|||.||.|||...:.|::
Human    27 SPGSRV-ILYTAFS-FGSLLAVFGNLLVMTSVLHFKQLHSPTNFLIASLACADFLVGVTVMLFSM 89

  Fly   100 LASM------GLP-RNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAI 157
            :.::      |.. ..||:|..     |..|..|:..|..:.:|||..:..|:.|:.......:.
Human    90 VRTVESCWYFGAKFCTLHSCCD-----VAFCYSSVLHLCFICIDRYIVVTDPLVYATKFTVSVSG 149

  Fly   158 FIISMCWVAGTIVGFLPL----FGWHADVNHN--QE----------CLFVEVMDYNYLVFLYFAT 206
            ..||:.|:       |||    ..::..||.:  :|          |..:....:..:.||.|  
Human   150 ICISVSWI-------LPLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLIDFLLF-- 205

  Fly   207 IITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAA 271
             ..|.|:|:..|:.|:.:..:|..:|.|  .:|.:...|.:..::|.                  
Human   206 -FIPTLVMIILYSKIFLIAKQQAIKIET--TSSKVESSSESYKIRVA------------------ 249

  Fly   272 RKRDVKATQNLSIIVLFFMICWIPLYT----INCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPV 332
             ||:.||.:.|.:.||.|:|.|:| ||    |:....|....|::.    .|...::.|||:||:
Human   250 -KRERKAAKTLGVTVLAFVISWLP-YTVDILIDAFMGFLTPAYIYE----ICCWSAYYNSAMNPL 308

  Fly   333 LYAYHLKDFRAALKNLL 349
            :||.....||.|:|.:|
Human   309 IYALFYPWFRKAIKLIL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 47/190 (25%)
7tm_1 58..334 CDD:278431 76/302 (25%)
TAAR8NP_444508.1 7tm_1 48..310 CDD:278431 76/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.