DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Ptger2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_112350.1 Gene:Ptger2 / 81752 RGDID:620020 Length:357 Species:Rattus norvegicus


Alignment Length:296 Identity:68/296 - (22%)
Similarity:123/296 - (41%) Gaps:64/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SDSPSSELNIPYTVFEVLVAIVSIIGNVLVI-IVFRRER-----KLRRRT-----NYYIVSLAMA 86
            ||...:..::.:|        ..::||::.: ::.||.|     ....||     :..:..|.:.
  Rat    22 SDESPAISSVMFT--------AGVLGNLIALALLARRWRGDTGCSAGSRTSISLFHVLVTELVLT 78

  Fly    87 DLLVGALGIPFAILAS-------MGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYP 144
            ||| |...|...:|||       :.|.....||.:....:......::..|.|::::||.||.:|
  Rat    79 DLL-GTCLISPVVLASYSRNQTLVALAPESRACTYFAFTMTFFSLATMLMLFAMALERYLAIGHP 142

  Fly   145 MAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQEC----LFVEVMDYNYLVFLYFA 205
            ..|.|.|..|..:.::...:....:...|||..:...|   |.|    .|::.....||..  :|
  Rat   143 YFYRRRVSRRGGLAVLPAIYGVSLLFCSLPLLNYGEYV---QYCPGTWCFIQHGRTAYLQL--YA 202

  Fly   206 TIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGA 270
            |::  .||::|.......||:..:|..:.       |:||           |.|.:|:.||..|:
  Rat   203 TVL--LLLIVAVLGCNISVILNLIRMQLR-------SKRS-----------RCGLSGSSLRGPGS 247

  Fly   271 ARKRD----VKATQN---LSIIVLFFMICWIPLYTI 299
            .|:.:    .:.|.:   |:|:.:.|.:|.:| :||
  Rat   248 RRRGERTSMAEETDHLILLAIMTITFAVCSLP-FTI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 44/189 (23%)
7tm_1 58..334 CDD:278431 65/271 (24%)
Ptger2NP_112350.1 7tm_1 39..314 CDD:278431 65/271 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..255 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.