DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Gpr12

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_017453952.1 Gene:Gpr12 / 80840 RGDID:68333 Length:419 Species:Rattus norvegicus


Alignment Length:333 Identity:89/333 - (26%)
Similarity:149/333 - (44%) Gaps:53/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LHAATTSKDAKDSDSPSSELNIPYTVFEVLVAIVSII--GNVLVIIVFRRERKLRRRTNYYIVSL 83
            :.||..|:.:.....|...:| |:.:  ||.:..::|  .|.:|:::......||......|.||
  Rat   110 ISAAVPSQGSVVESEPELVVN-PWDI--VLCSSGTLICCENAVVVLIIFHSPSLRAPMFLLIGSL 171

  Fly    84 AMADLLVGALGI----PFAILASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYP 144
            |:||||.| ||:    .||.|......:     |.|:.|:|...:.|:..|:|::||||.::.|.
  Rat   172 ALADLLAG-LGLIINFVFAYLLQSEATK-----LVTIGLIVASFSASVCSLLAITVDRYLSLYYA 230

  Fly   145 MAYSRNVRTRTAIFI-ISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFLYFATII 208
            :.| .:.||.|..:: :.|.|...|.:|.||:.||:. :.....|..|..:..|....|..:.:.
  Rat   231 LTY-HSERTVTFTYVMLVMLWGTSTCLGLLPVMGWNC-LRDESTCSVVRPLTKNNAAILSISFLF 293

  Fly   209 TPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARK 273
            ..| |||..|..|.:::::...||.       |.....|....|||.                  
  Rat   294 MFA-LMLQLYIQICKIVMRHAHQIA-------LQHHFLATSHYVTTR------------------ 332

  Fly   274 RDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIIL-SHLNSAVNPVLYAYH 337
               |....|::|:..|..||:| :|:..:.|    .|.:|.:..:..:| :..||.:|||:||:.
  Rat   333 ---KGISTLALILGTFAACWMP-FTLYSLIA----DYTYPSIYTYATLLPATYNSIINPVIYAFR 389

  Fly   338 LKDFRAAL 345
            .::.:.||
  Rat   390 NQEIQKAL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 52/174 (30%)
7tm_1 58..334 CDD:278431 76/281 (27%)
Gpr12XP_017453952.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.